SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_01954 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_01954
Domain Number 1 Region: 155-223
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.7e-18
Family Ypt/Rab-GAP domain of gyp1p 0.014
Further Details:      
 
Domain Number 2 Region: 64-131
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000085
Family Ypt/Rab-GAP domain of gyp1p 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PITG_01954
Sequence length 266
Comment | PITT_01954 | Phytophthora infestans conserved hypothetical protein (translation) (266 aa)
Sequence
MDAQPGASADAQLRQQYDALLAGDSITADYERWRELKRLVIVHGLPRDEGFVTDVEGSNV
SLCSLRGRVWKAFLGVENDVDMTKYAALVGRGASHYDGDIRNDTFRTFRGDLEFAQRVPE
EKLVRLLNVFINELGSNPGEEKQDDGETARNGNLPSIRYVQGMNVLCAPLLYVLPEADAY
HTFCQLLVRHCPHYMAPQLKGVEKGCALVDKCLETLDPDLYQHLSSRGITARIYALPLIL
SLFACVPPLHELLRVWDVWAFTLSWY
Download sequence
Identical sequences D0MUH9
PITG_01954 XP_002908543.1.21288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]