SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_02531 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_02531
Domain Number 1 Region: 237-386
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.4e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0058
Further Details:      
 
Domain Number 2 Region: 362-477
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.51e-21
Family Ypt/Rab-GAP domain of gyp1p 0.019
Further Details:      
 
Domain Number 3 Region: 22-131
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.34e-18
Family Calponin-homology domain, CH-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PITG_02531
Sequence length 1100
Comment | PITT_02531 | Phytophthora infestans hypothetical protein (translation) (1100 aa)
Sequence
MEDELAAGVVLSPTRNLSKDGEIVRRWMEMVLGDKSLGDLPAALHSGELLCDLINKLYKA
LGMKSQISPVRAQGDDMDAWSNVREYLRACEVLGVARQDLFQPEDLLSRKDMEKVYSHIL
ALQTVAVSLSNRRSIDERSSMINAPDWSPVSEHGVFADDEDLDAEDLDLDSPEAVNMLQQ
SRWQRLLFEYEHQQQRKEERDRAGDSSASEGLGPLAHGIWRTEERIRAILMREDRDFGAV
PEELHGKLWMLASGAQLEMRKSEGQYERLLASESESTEATRQIDVDLHRTVANEDKELWT
EEKSRMMRRVLVAYSIYNPGLGYCQGLNYIVARSLQYLGEEEAFYLLVVIVRLVPDDYYT
TMLGLAVDQHVFADLVRLQYPEISEHLSELGGSGMELSLACTEWFLTLFASPCERGVTFQ
IWDAIFLQGDEVLFRVALALLQPAKTALLACNNYGDMLKHLNELGRGELDALELMQVSKN
QDCVIRGRIEDFRAHHRLQLASGIVASTVEAEDARTSSTGRRSSEVRSEPRLRIFGRKKP
GIFRHIDRIPPRLARTFDRKLTEDYMETIRQDHPNFAQYYEGLQPQIIEMYWGSADSYRQ
WGARNVRRISTDGFAVSSSKDNHQMSPNVSGERRRELTRDRRSKSFMHPKKVQHNSANST
PSSRAVKDSDEDAQLIGRSPLAWIQRFEEWHKDLKTQKEKKKAEKRLRRNQRSESLFPGS
RHGQPDPWMRGATDSSSVPIYPQPKQSQDIEGFSLGHRRRSNEYQGPSPENIPMLEEPSL
SRSYSDPFRSPAGIAAHSLRKHASEKTCRESEQCPMLPQHPLTKRNIDQVPQKADVDEVR
KLGGSSNGRASRGFSDQSTLSRSTNSYVNTASFTLDPQEEIQDESNSDASLDEKNAKLHV
DDEGLSPTLAQLEKPLAHEVMFSPFHCRSTSMDFAAALQHEEPGSCAPPQIRRILSVPAD
EMSILKRPRHPKRDCSQAMRERANVLQYMHRKASDASSIAGSIPRSPARMSESSSDSSRF
GDHTSNRSGKSMHYRKSSFSFFDKLSSDLENSTHGLDSLVDESEFNTDGIGRGSMSSVAT
GRSSTVDEQRPMGGAISISS
Download sequence
Identical sequences D0MWK1
PITG_02531 XP_002907450.1.21288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]