SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_03474 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_03474
Domain Number 1 Region: 199-319
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.49e-20
Family Ypt/Rab-GAP domain of gyp1p 0.0071
Further Details:      
 
Domain Number 2 Region: 58-224
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00000000000000418
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PITG_03474
Sequence length 388
Comment | PITT_03474 | Phytophthora infestans conserved hypothetical protein (translation) (388 aa)
Sequence
MGSKRHDRRRVRGIPGRALAARERRLIQHKEKQLRVVIIRLRALVRDSSVATVEDRDECF
REVRRLAITPKGLVSDEFRRDLWPFLLGIGEATHNTRPVTNSDLVEVHRDAAQVEKDVER
SLWHYDVLQGIKESERRAKRRALTQIILGALSANDELFYFQGYHDIVSVFLLTLGSSPTT
MQAVQNVSETYQREPMRPGFEQVMATTRLLFPLLDAADELLFQHLRASGVEPFFALPWMI
TWFAHQLKRFGDVKRLFDVFLVTHPLFSLYVSAGVVLEARDKILRCESDFGTMHGMLSNL
PLSMDVEKVIARALVLFHQLPPEQLIKQSDMDAGSVQNAYFRFPLKFQPWPSVTKPVLKD
ISIIATTVIGVVAVASAYAFRDRIVLHA
Download sequence
Identical sequences D0MXP5
XP_002906542.1.21288 PITG_03474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]