SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_03623 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_03623
Domain Number 1 Region: 368-526
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-36
Family Ypt/Rab-GAP domain of gyp1p 0.0023
Further Details:      
 
Domain Number 2 Region: 505-619
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.53e-20
Family Ypt/Rab-GAP domain of gyp1p 0.0099
Further Details:      
 
Domain Number 3 Region: 66-155
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000113
Family PLC-like (P variant) 0.05
Further Details:      
 
Weak hits

Sequence:  PITG_03623
Domain Number - Region: 240-284
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0481
Family PLC-like (P variant) 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PITG_03623
Sequence length 712
Comment | PITT_03623 | Phytophthora infestans conserved hypothetical protein (translation) (712 aa)
Sequence
MAVAHEDPAASACIDTKSAATKWVHRTILPAVSASTDQTPGRILKKKLRSKATKLFSTSN
ASSSKRLCVEVVGARNLESPQSVDAYCVVELCDIKPKTARGRPRLAASPSFRSSTVTDSK
SPTWSHVAEFVVPARPASVRLRVQLFSEKNFFFDMFPTNSSSFDEEGEKNRNQIDYPAKE
HSVLRPQIYINGSKGIYDSDSDDVVTLSEEEDENDEFADDDDVWPVIEEKIAATTESIDD
EMLGAVEINSNLLCKPSRVATDSWYSLGGTRTGEVRIRTVWYERAKRALTAQDREVLFEE
HVSHFMAKPVSDFYGFNIPESARKEWVHLRSYQDCREERRVEDWTKIYGTQFPERLRRCS
YKEKDTEEKALLIQLARAGIPRHLRECAYVNLSGAGEKQANAGPSYYAELVKKAETMETE
TFRQIELDIDRTFGHSGTKLCSESGRDQLRRILQAYSLRNPSVGYCQGLNFIVAFLMLIA
DEEVVFWLLSVFCEDLYPGYYSPAMSDIQRDMLVLKQLIAEELPQLDEFALDVGLPLELL
GSQWLLCLFTTTFPSETVFRIFDCIFTEGSSFVFPVIMAHLRRMEPKLLDLVEFHDVLSS
IKDTESACIDGDLFMSAVFKETESITAFRVQRLRQQQCGSVRSEMERAERARAFNQQLAV
VYQIPAFSSYAAGLFRFFHEEAEGASRSDVAFVLTMLCHGLVWLAEHSKRWS
Download sequence
Identical sequences D0MY33
PITG_03623 XP_002906680.1.21288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]