SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_04634 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_04634
Domain Number 1 Region: 366-505
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.15e-20
Family Ypt/Rab-GAP domain of gyp1p 0.022
Further Details:      
 
Domain Number 2 Region: 480-584
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000000000000136
Family Ypt/Rab-GAP domain of gyp1p 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PITG_04634
Sequence length 635
Comment | PITT_04634 | Phytophthora infestans hypothetical protein (translation) (635 aa)
Sequence
MAGKKSNAMAAKYPRANALVGSVLNKYHNGSERAVDSFVIRTLKEHEPRLLGIQCFLDQG
PAENSRRIKDESHVAQHTPCASGVFGVLSVCGGLFGPGAIMRQWDACSGTEGEPDDRESA
MTEYVATVDKILPGWDEAVPNHPVASPDRFWEDDAAAAQCPLCSVVFSEEEQKLRSLAVD
AGCDVQALDEAIQKQHGGSLIGSAPMEIPIPPAAHRFASAHTSVEASNQLALAHRQLTMS
FKMAQCRAHKVLDKMDATIAALQGALIAQRAPSNKSPPSGHSEDNGWRDNRTRTFVADLA
EAVQALLDASSGSDTEDSDANEAPVSMSRPSWEKPAQTDPPTSVPSVPSSMELEKAYELI
RSQCETGPASEWDEQIRLDVTRTFGISARRQHRKSVDPKSRTVCNSAGIAIPVEKRRSAL
ENVLRACASVDTDVGYCQGMDHVAALVLAVSDWNEARAFWFLVSLLASPRFELERLYGPG
LPHLSLRCFQLDRLLGIHLRPLCEHFHTIDFPISIVATGWFMTLFTNMEALSYDVVVQVF
EGFIFKGWKQLFQTALAILQDLQGPILASSFDEIPRLFYDIQEYAVQKALRFLIDIARND
TGTVVKTLGTTRRRFPACAFIVDWGVQPVLAHPQQ
Download sequence
Identical sequences D0N1P0
PITG_04634 XP_002905378.1.21288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]