SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_06614 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_06614
Domain Number 1 Region: 9-171
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.7e-22
Family Ypt/Rab-GAP domain of gyp1p 0.0033
Further Details:      
 
Domain Number 2 Region: 150-236
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000000366
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PITG_06614
Sequence length 343
Comment | PITT_06614 | Phytophthora infestans predicted protein (translation) (343 aa)
Sequence
MVSDWFETSGARKLRDASAHSYQEHLRHSESCVSPLFEEDARQIELDLPRTGESIRLFLL
SHSEREAFQEDEELPQHVMQRFLPQLKNILVAYSMRNPRVGYVQGHADVLCFLFGNVNER
RDEEETFWVYASVIERVFPEDFFARTPKLHGFQVDCKLYNELVVRKLVPLYPILAKIDLP
LVTTLLSCKWFVSLWVGELPLPLLYEVWDTMLREDDGTILHLLVALHFFRLAVDEIQLHM
EMEQWDSSYIYKIILGQCQNATEIAPQTLLQQAQTLYGFKDESVEDMRAAIRRLPQLRKA
ELTVLAKQTHFSRLEMERLQDEFTFLRYQRKTCGRSKLRGLTQ
Download sequence
Identical sequences D0N596
XP_002998701.1.21288 PITG_06614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]