SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_06833 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_06833
Domain Number 1 Region: 44-331
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.66e-35
Family WD40-repeat 0.0022
Further Details:      
 
Domain Number 2 Region: 571-684
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000000000000445
Family Ypt/Rab-GAP domain of gyp1p 0.012
Further Details:      
 
Weak hits

Sequence:  PITG_06833
Domain Number - Region: 455-589
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0654
Family Ypt/Rab-GAP domain of gyp1p 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PITG_06833
Sequence length 920
Comment | PITT_06833 | Phytophthora infestans conserved hypothetical protein (translation) (920 aa)
Sequence
MVQTLVLRATQDDVIWPRRPLVSSKGLLSCVQNLPLSSYDKRPTTFRAVAFNVSGELLAA
TDERGHIFVFFVTANRYSLVQHLGVPTISCCFSPRRKTELLVTCEDETVRCIDVQSQTLI
STLRGHRLPARCASFQKSGQLALTASQDAVILWDTKDWSRYRVLNAGPGVEEAIFVTKGN
LVAVCFQDDTIMMWELESLALRYRFSLPEKEQSPGLQKIAVSDDHQVLVASGRAPFIYVW
EFESQTIIRIIELPPPIKQVVSHAFLPGHNSMLSILADDGGVFFLDVAAKSPQIKLEISN
RGRTATAFDIECHARYLAASTSDGFLLLYDMEITRETAARAQERRRKEGLLELGDHARLR
TRSGRPVASKLIDSLFGAKYPRHGASATRARVRATGGSFTVPSKDVKDSECLTLRERVRT
RRTNPLTRPFAQLSAQEIEVNRKRLVGSLKVSGMFPRKYRVLVWRFLLRLPKNEEAFRSL
VAKGKHPVFVRLKDHYPLQDGRLFRRLHRLLSAIVYWCPAFGEVSYLPAVVYPFVKIFRE
NDLAAFEASISVLLHWCGDFLISLPYPPVFAMRAIEHELARRDSQLFDHFTRYQITSEAF
AWSLLKTIFTEVLSEDEWVCLWDHLFAFSDTPQLIYVAVLAYLSYFRTALLAACDRFSIE
QFFHQQNAIDIQKFVQLMMNLREKLDLSEPYWPLSRGQYPAFAHYPRFVVDFQISERNRI
ALEEAELARKQSLFDQIEQDSAKLKAEHEKWMKERKIVLEAEERRRKEAIAAEKERILHL
KTLDYQTRKRRLQHLSNMEKSASESLEEASKMLQTEYQRMESALAMQKERMEFEISSRKQ
EEDLQRVEVETHDRVRGIHKQREMEERLSRLRTEFETRLKQQELQYLLKFESWKREDEEQ
TRNARAKLRQREETVGAATC
Download sequence
Identical sequences D0N6K0
XP_002904817.1.21288 PITG_06833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]