SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_08141 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_08141
Domain Number 1 Region: 287-461
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.15e-23
Family Ypt/Rab-GAP domain of gyp1p 0.0075
Further Details:      
 
Domain Number 2 Region: 437-541
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.18e-20
Family Ypt/Rab-GAP domain of gyp1p 0.0055
Further Details:      
 
Weak hits

Sequence:  PITG_08141
Domain Number - Region: 249-299
Classification Level Classification E-value
Superfamily F-box domain 0.00523
Family F-box domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PITG_08141
Sequence length 587
Comment | PITT_08141 | Phytophthora infestans conserved hypothetical protein (translation) (587 aa)
Sequence
METSATPASHLEDLPLAPAPAATSPDSSSSASSSGGEEPAEKLPPAAPVLKPLDPASDED
AGDAPTATGNGASAHGLAGAFGLMKDRAATAKKTLGPQLLNMKDMTSKKLEKYQPTIVKA
KTSATAGLTTAASKMKEGSTQGWSMLKTKLAAAGPVAERIHTMGLNVMTDIYLGDTTVDA
LGYVDDPKSASCLFLHKYKTGNPSSDSPSKTMGLLRMTRTISNSSVQSTENEPVAPVAPG
DQCLATPYILGNILLYCGDLPVLARVSCVNKACRDFIASERRLEKFCVRYGQLPSSLRFA
YWEKSANVRKTRDTAELDYDTYLQMAISKGDATESILTDVRRTYGRVAPHKRAANHKDHV
SEEDLTTQLSEILHALAGRFPAVGYCQGMDYIAAHVLNKVKKSGSAADTKAEAESTFWLL
VTLFERYELHDMFAPGLHTLHVHCFQTQRLLELTEPALAGHFASEKVPIEMFAVGWFQTL
YLYLNVLPQDSLDRIWDVFLFEKNWKIMLRMALALLQLSKEHVMEKPIDEIMQFFNTFAD
NADEILAESPLTERALRLKVTNTVLTKLQKQHVKHKRASPTKTQTFS
Download sequence
Identical sequences D0N9K0
PITG_08141 XP_002904310.1.21288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]