SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_08514 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_08514
Domain Number 1 Region: 101-223
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00000445
Family Ypt/Rab-GAP domain of gyp1p 0.0087
Further Details:      
 
Domain Number 2 Region: 489-522
Classification Level Classification E-value
Superfamily WW domain 0.0000668
Family WW domain 0.0042
Further Details:      
 
Weak hits

Sequence:  PITG_08514
Domain Number - Region: 562-680
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.000134
Family Single-domain sulfurtransferase 0.071
Further Details:      
 
Domain Number - Region: 12-221,265-351
Classification Level Classification E-value
Superfamily ARM repeat 0.00575
Family Armadillo repeat 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PITG_08514
Sequence length 923
Comment | PITT_08514 | Phytophthora infestans hypothetical protein (translation) (923 aa)
Sequence
MASPSARAASSPVSDLRHQQQEALGKILSRRSMRVWSSKSSQERSSLAESLLQLFSSGSS
SSAASSAAEIAQRPITRRPGVEEVKNCVLSSVYPCLPPQCDPLRGEIWQVLLNVYKRNQH
GSAAQEFDRMLQRLGKLPRDPLLVDECGDVAEILEPSDLKSRERVQQELEVLLMWFLTTK
SVAYSTGMARVVAPFFLLKMPLPTIYDCFYQYCAHFLPHFVVADSLFADSPGLSAAGGGQ
GSNRGSSSSMDEAFSGQRGALERSSSMDSTSSLVEESKRRADEEEAQTLRRERQQLVEQL
LSYHAPQLAHFLNQWCGNEWRSAGKLFAADFLLGHLYQVVPPAAFVYVIDQYLLTGDSLF
GLFFVIAALIQREEEFSVCGSTEQVQDQIRATFDLKAFADEENVRFLCLSASRLRSKTPR
TYKCSQREGSADIRCCSRQAIEIAYGSGAGMAAKKVRAKSSNNLSGPPSGGLSAPSSNDR
KSTAEAAVDMSQWVMKESRSIAGKIFWYHTQTGKTQWEHPAEKHDPPSAYFALPVSVEEV
GAQLMGGEKPGDQQGTGSGSLRFFVVDCRGLRSSEDLKSGRIPVAYTLDPSVFDSPELIA
KSMEAFNPMKSQVHVVLVGHGVGIPHELVTSEDVKTSIRDAVRLDTDCLNQAALFFQKRG
FRFVSTLDGGYSSWHAFMRDRAGSSPQELLNHVAEQCVYCRYDTILRTGEDPCKKKTKSK
PRRKKAMPTMTSMPVNGGEGDASIVSTSELNRTSSTSIGSNGSSSRRQLSLSRNSITSMR
SKLSEVSIPKKWNWRRRSSAASASNQNDSGSSSETATVEDGGSDHGSSTDDQEEKSDEVT
HEMLRAALEEPEDPNVEAADARDSKFVGVFTIDYSEDEDEDNKEPAAENNETDSAEVLKS
TEHEEAPAIGAVAGAETEPTVLA
Download sequence
Identical sequences D0NAT3
XP_002903886.1.21288 PITG_08514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]