SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_10300 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_10300
Domain Number 1 Region: 1-246
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.02e-84
Family ETFP subunits 0.0000000927
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PITG_10300
Sequence length 251
Comment | PITT_10300 | Phytophthora infestans electron transfer flavoprotein subunit beta (translation) (251 aa)
Sequence
MKVLVPVKRVVDYAVKIRVEPKGVDLKNVKMSMNPFCEIAVEEAIRLKEKKVASEIVAVS
IGPKQSQETLRTALAMGADRGIHITTDMRTDQELQPLAVAKLLKEVVAKEGPKLVICGKQ
SIDADAAQTGPMLAGLLDWSQGTFASDVAVDGDAVNITRETDSGVETLKLGLPAVVTADL
RLNEPRYATLPNIMKAKKKKIETLAADSFGVDLAPRIDVVEVKDPASRKAGIKVASVDEL
VDKLKNEAGVI
Download sequence
Identical sequences D0NF02 Q8H718
XP_002902119.1.21288 PITG_10300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]