SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_10892 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_10892
Domain Number 1 Region: 3-75
Classification Level Classification E-value
Superfamily PH domain-like 0.0000347
Family Pleckstrin-homology domain (PH domain) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PITG_10892
Sequence length 273
Comment | PITT_10892 | Phytophthora infestans hypothetical protein (translation) (273 aa)
Sequence
MEQIPLESSTRLVHPTSRDLRRLRFTLQDGGIRHRFQASDEAAYEKWCVAIADAIGGAQE
MEQTLQTTNEKRNQVDHLHAEVYDRNTTNYKLIQLHRPDAKSRTVVSEEDQHEDCSPIDL
SRPLDVHYDAYEPDEKVLVHRLPCNKQPRNILVSQLSVAPEDINFDNRVDICIEKQQSTE
LDTATIRSSDDEEESPKHYPARWRDLCQFPSVFERPVKQWGRIRPLSTRETLRRRLMSDA
RKHCILPYGSPKQPEDEVEGTFNLGFPIKMSAS
Download sequence
Identical sequences D0NHC1
PITG_10892 XP_002901704.1.21288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]