SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_13348 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_13348
Domain Number 1 Region: 638-824
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-35
Family Ypt/Rab-GAP domain of gyp1p 0.0032
Further Details:      
 
Domain Number 2 Region: 799-918
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.45e-20
Family Ypt/Rab-GAP domain of gyp1p 0.0098
Further Details:      
 
Domain Number 3 Region: 11-168
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.49e-18
Family Ankyrin repeat 0.0034
Further Details:      
 
Domain Number 4 Region: 182-223,274-317
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000111
Family Fibronectin type III 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PITG_13348
Sequence length 971
Comment | PITT_13348 | Phytophthora infestans conserved hypothetical protein (translation) (971 aa)
Sequence
MRQRGVEMVLLKLLFEHDPAGISIVDANGSHVLHLAAIHGNLDVIKWCAELVSPPSGKES
VTNAKSEISRYLLHLGTTSLSGRNMLHYAAYNGRLDVIKWLLREDKPRRGELALTALDVT
GYSVLHYAAMAAPLEVCEWLVLEAPGRHQLTLTARTKEGKTALELASTRPASIRHFLAEI
SQVPRVPSNLRCIGADTTSLGVSWSVEPASNDTRLGEELKPMYFHLEVCKKPVSLSRASG
FLTMLMLMPSTSPGSPRAPSAVSSALLSASSLLHWEPLGVLLQPEAREHWLCCLERDTEY
LVRMRARNRNGFSGYTVPNLSGVFTTGDGGRRRSLSSLQRFFGAINEDRPAESIALSFIG
DLHFELLEARGLPRSSPVAIPTSSNLTNKAPQERYYAVVTVETPSTPDVACSESSCSSTR
FIYCGRSQLATLQHDLVVTGSPQVWRHPRFSLKSVFRAPEALALTQVTIAVHHESQDQRE
SCCVGKLSLSLLSLVQGMPAKMQWLPLVNVISPETNGGLVLVRTLFLPNGVSALPHATLP
NTWPATAEELLSASGQDDDSGSPPGSSSSTASTSSSSSSSSQFSHPSMLVDSLGFGVFDP
EMKLWNGEWQRSKSVSGVTRSYAYYKLLIEGIEQQQEKRWRLELAWQGIPMSRRPEAYTQ
MSGALITKTHYPGNYFLSLIKRLEDPTDEVHSGAIASRFSVAKKQIQADLKRTFAGNDKC
WLTSPMGQQSLERVLLAYALHNESLGYCQSMTFVVGRLLCLYHSQRPKSSDDPFQVEERV
FWLLHVICEDLFPSYYTQGMTGLHVDGGVLEKLIRMRLPKLHRHFQRLHLPPMGLVLVTQ
WLLPLCCAAFPSETTFRFLDVLFLEGSSVVFAMAIALLRISQHELLAQNVDCSQLFRFIR
ARDQRLHDAPLLLEVAYQEHQVLSPQIGSLRQNVAQELGIYKGENVQVAKPMKLSSLPVD
ELRPGDVEIHI
Download sequence
Identical sequences PITG_13348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]