SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_15335 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_15335
Domain Number 1 Region: 4-114
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.08e-16
Family Thioltransferase 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PITG_15335
Sequence length 120
Comment | PITT_15335 | Phytophthora infestans hypothetical protein (translation) (120 aa)
Sequence
MELVTKVRDAEHWVQVLESSEKKLVVVDVHKDWCGPCKIVEPSYKRLTTDIEHAERRVMF
ATLNVGLHVDGIEDTGSCKPRFLLFKDRKQIADVDGANAPLLEQSVKQHLPPIGNDDEEN
Download sequence
Identical sequences D0NIM8
PITG_11375 PITG_15335 XP_002898773.1.21288 XP_002900972.1.21288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]