SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_15924 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_15924
Domain Number 1 Region: 478-589
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-21
Family Ypt/Rab-GAP domain of gyp1p 0.0038
Further Details:      
 
Domain Number 2 Region: 193-319,424-444
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-21
Family Ypt/Rab-GAP domain of gyp1p 0.0034
Further Details:      
 
Domain Number 3 Region: 38-140
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000255
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PITG_15924
Sequence length 605
Comment | PITT_15924 | Phytophthora infestans hypothetical protein (translation) (605 aa)
Sequence
MEVLRPPSSPSSKSNVWERLLQTFSVPAPVVNRFLPKLKAGPLLLEVGQPPEWKPFEVVL
AGASPADLGLYYYPHKDAATPMGCIRLQNAHIDSLEEVLMVVTKDKTWFLCADHVRDASD
WSDAICNAIERVSSDGVQEHRHRLGSGVTSVTLCELQTRDAKARVDEFLEVFVRSTREDL
CIQAAKGALSWSCMRSLTWKVWLEYIPSDVPFSQWTSIARDKRQRYDKERSKLKLFQNLL
VGKQRPEEFLSLCETSTDSLLYSIYKDVRRTRGEMPFFRDPFVQCLMIRVLYVYSTTHSE
ISYNQGMGELLATLVYLLHIEQWPLEEDDIEEVVAAECDVEVDGSLSGSYFFPATKVQDA
SSEDDPSYVYVESFINIQNDDSFLDRDSILRLAPFAGGSGKYYECCRDAAAEIVRELTAS
EFIEHDAYLLLEDMMLRMAGTYCPHAPIPRRNSKPQADKPLSSADQLPASPLDDQMNRIH
HHILSRCDPPTAKHLANLGVEPQIFLLRWVRVLMAREFETAQVWQIWDAIFSLTPSDFSF
INLLCVAVVREFREEILAAEDATTVLLSLRDISSRIEPARLVDNARDLYDALLIAAAVEA
SMGSA
Download sequence
Identical sequences D0NS23
XP_002898151.1.21288 PITG_15924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]