SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_17493 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_17493
Domain Number 1 Region: 405-490
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000000000759
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 
Weak hits

Sequence:  PITG_17493
Domain Number - Region: 249-328
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000288
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PITG_17493
Sequence length 523
Comment | PITT_17493 | Phytophthora infestans conserved hypothetical protein (translation) (523 aa)
Sequence
MAALRYEKETGLEERAILLTEQLAAMDQLNEWKHAVKKEFTQSQYSVDQVQSLRRMDNPL
MYSVLEKMGLLGLIKRTVIDLHCEAMQTAAAASKKHLKNSLDDGLLLPEVRATDGCSLDA
VRAARDNWEMITSDEMMRVANELGQPLPNKIQAARFLYDGIDLLRSLQAIEPLNRAHEST
ETSADTWGSIQLQLYSPPFPEYRRLFSELAPEFGQIGLDELFPTQRGAFIAEKIRVGDLV
LAHQSVSMARQYSKTGCPVSLRPQIWRQVLSVPITALDRNYYAQLQQQVAQWAYLTDDMY
LLDLQQTINSCDYFVFQDHLESVLMAFTRDTYVKAQALQVNGAVTCSLVPPNGVLPFSGL
VMYLAPLAYLFADPVEIYYVFRELYIRYWSKLNVIRTERGTILPLCKLFEDLIVRSSPAA
VFHLRNIGLKPLDVAFPWIQSAFSGVLDIDQVLLLWDRVIGYDSLEIVVIFAAALFSFRA
DELECVSTREEVDDLFTELIDIPVVTLLQDYLFGLQYQVSKNQ
Download sequence
Identical sequences D0NWE7
XP_002896557.1.21288 PITG_17493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]