SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_17882 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_17882
Domain Number 1 Region: 439-751
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 5.76e-72
Family Regulator of chromosome condensation RCC1 0.002
Further Details:      
 
Domain Number 2 Region: 931-1121
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.1e-38
Family Ypt/Rab-GAP domain of gyp1p 0.0037
Further Details:      
 
Domain Number 3 Region: 1105-1204
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.66e-16
Family Ypt/Rab-GAP domain of gyp1p 0.012
Further Details:      
 
Domain Number 4 Region: 10-89
Classification Level Classification E-value
Superfamily PX domain 0.0000000183
Family PX domain 0.0057
Further Details:      
 
Domain Number 5 Region: 185-344
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000663
Family BAR domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PITG_17882
Sequence length 1289
Comment | PITT_17882 | Phytophthora infestans conserved hypothetical protein (translation) (1289 aa)
Sequence
MLGFYQAQHAQNRKPFLAYVLQVCTANAHFLVYRRYSQIASLAAKLHFHPPVGLPPKYAL
QVFPLSSVQLQQRFDGLQSFLREVVAHLSRQHAAGMHHDTSSSAGLDMQIFCDFVAHHRN
RPPRPVKGELPDWAKPTVETTAWADADSVTDSEDVGIESDGSDQELLEQVDIIDVSTRFR
NDVLQAEGNISALWHCVRAYMQATTAWWGATTAVLDEYKRVADMSLFADAQDGNTHAARL
VQALHQLLESVQPEFEKKCEDAVLSPLGALSHEVLPEIKHTFWTRHSRVDHENAAHVRRL
QQERESLQAKLCTDVQSSMTALVALQNEMLAVLHDRLQGFERVQRMPRKRSKSQPVLNRR
TRRASGTSPRGITISLSTMTSAAQVNDQQGDVGENQELQASTVSIAAESDQVDGDESDDE
EGSVEDAVDVVELEEGDDATQVEEPSSCMYVWGRPPSLEGGTPLVLRPKHVSLANGQPIV
QVACGGEHLLYLTSTGDVYSYGDNEDKKVAAVTVATHTSTLPDNESTRVVSTSSFLAPHL
VEELALEKALHRTTIAMVACGAQHSLAITDAGELYTWGSGEDGRLGHGDMRDRAVPRKVM
SLLRESVVSASCGGAHTAVLTAKGSVFTFGRGRNGRLGLGDNKWRDTPHPIVGFPQGTSI
SLVVCGWNFTAALDRQGSVFTWGKTGEGQCGLGYVDRDQVVPRCVDKLRDVAGSSVVDVA
CGYTHTVVLTASGELYSWGLGEYGQLGTGDVYQPLPARVQLPADALCAPDQLARVYCGAF
HSIATTEQRVMFAWGLNSYGACGLGHTANKDKPERIDCFSSQTELVVACGHKYTIALEVN
ASLYTHSPSQTMLPTGAALNGLEMPPSTRQVSEGSEASDDDPNLGRVSPSRPVTPPRRHR
RGTPPTLAMDLSHLPREAIHEKEEELRRAKKLWRTRILRDWEENKDTPLAHSLWRQGIPP
SIRARVWPMAIGNKLKVTPEMFKIYRRRAAAYKSDRASKEDTVDGGREHTLALIDTDLPR
TFPSLKLFDASGPYYAFLLEVLETYACYRPDLGYIQGMSYLAAMLCLHMPQDRYLAFQCL
ANLMVNEHLFTFYLLDADLANVYYTLFDAFLSARLPHLHAHLRDVGVFSCSMYLMNWLQT
LFLQVLPLESAARVFDNFLLDGTVFLFRTAMAIHELLAPQLMRAEMDVVLPLLQHNVMHQ
DVWTLRVSEQALFDTVATIAVPSHIYSALDRVVNDVFFYEKRGDPESMGGKRMMAFASGG
QSVGIGHVKHQRRRMYAISDALNGVLGGF
Download sequence
Identical sequences D0NWX5
XP_002896421.1.21288 PITG_17882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]