SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_18461 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_18461
Domain Number 1 Region: 126-191,236-358
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.97e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0062
Further Details:      
 
Domain Number 2 Region: 341-441
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.12e-24
Family Ypt/Rab-GAP domain of gyp1p 0.0076
Further Details:      
 
Domain Number 3 Region: 6-91
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000263
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PITG_18461
Sequence length 482
Comment | PITT_18461 | Phytophthora infestans conserved hypothetical protein (translation) (482 aa)
Sequence
MAAPHELVLQGYLHKQSDITYSTKSGRKPRLLLTLGDVQVIDDQNQVRHPGNFVFVLQTP
TRKLFLSATTEQERRRWVGELRVLLPGSYDDLHHLKKLQKRASKERRMERKRQQLPKLKR
TYTEVWLDEVFSHPSGSTRGDVPLLDALCFAGIPKELRGRAWAWILGNTLQVNEDLFQIC
KARAQAVLMEMSLKRDVDHSASPSRSVSNVSKISDRKRASQSSAVLPSQNMLQDAVGIAE
MLVAHGERSIKLVNVDMPRTFGHHPLFQPGGEGTERTTKVLEAYICYRPDLGYVQGMSYL
AATLCFHMDSFTAFKALAALMSSSLLFDMFRLEATRTFHYIDVYNQILEYELPALAAHFH
EIGIDAQMYAVDWALTLFTRSLPLDLALRIWDVYVLLGTPFFFQASMGLLSLFQDSLLAM
EAENIMRLLHNFPKNTSSRQLFKAISSVSLSCEEVTELLAGGKLWSPDEVREVPVKYPDT
YE
Download sequence
Identical sequences D0NX27
XP_002896384.1.21288 PITG_18461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]