SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_18959 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PITG_18959
Domain Number - Region: 221-295
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0418
Family Ypt/Rab-GAP domain of gyp1p 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PITG_18959
Sequence length 304
Comment | PITT_18959 | Phytophthora infestans hypothetical protein (translation) (304 aa)
Sequence
MGNFLVSSVCRAHGRSEAVYAIVRAQVEALRGHQRRGSPLQRRCAAQQAALLRALSSKMA
LTAAVMSCWVTAATNRARAALVASLVFIAKKFIARTSTQRSLPSQVYDDVFNEFNAVFET
APQPTKTLRELHVQHSAKLDAESLKAEAEAQQGGLNDFDDEYELLPKPEEDRAFYADLEG
NQVESDASQTDSVTEGERLLQLASSISDTSMRVEEFIINGKHDNFEVITKDVDDHAAEAN
ESEKRSIVRVLLAYCAYSEDSNYSSDMVLTAEECLQVWQGDEDRAFKSLAVLCNDVPRLC
AALE
Download sequence
Identical sequences D0NZ73
PITG_18959 XP_002997326.1.21288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]