SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_21590 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_21590
Domain Number 1 Region: 482-621
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.59e-21
Family Ypt/Rab-GAP domain of gyp1p 0.021
Further Details:      
 
Domain Number 2 Region: 142-214
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000106
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0043
Further Details:      
 
Domain Number 3 Region: 596-698
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000000000000889
Family Ypt/Rab-GAP domain of gyp1p 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PITG_21590
Sequence length 721
Comment | PITT_21590 | Phytophthora infestans hypothetical protein (translation) (721 aa)
Sequence
MAAKYPRANALVGSVLNKYHNGSERAVDSFVIRTLKEHEPRLLGIQCFLDQGPAENSRRI
KDESHVAQHTPCASGVFGVLSVCGGLFGPGAIMRQWDACSGTEGEPDDRESAMTEYVATV
DKILPGWDEAVPNHPVASPDRFWEDDAAAAQCPLCSVVFSVRERRHHCRLCFSIFCAGCC
SHVLEIALCPGAPRRSQRVCTPCFQAEYRAQQLRKARKISRENQELEQRIRAVLATARHS
FAAKQEEEQKLRSLAVDAGCDVQALDEAIQKQHGGSPIGSAPMEIPIPPAAHRFASAHTS
VEASNQLALAHRQLTMSFKMAQCRAHKVLDKMDATIAALQGALIAQRAPSNKSPPSGHSE
DNGWRVMIRHTDTFLTPTDREALQVVSEDLCSQLRSRSSSPVDCTSSVDPSIAVLWLTEC
LKDNRTRTFVADLAEAVQALLDASSGSDTEDSDANEAPVVPSVPSSMELEKAYELIRSQC
ETGPASEWDEQIRLDVTRTFGISARRQHRKSVDPKSRTVCNSAGIAIPVEKRRSALENVL
RACASVDTEVGYCQGMDHVAALVLAVSDWNEARAFWLLVSILASPRFELERLYGPGLPHL
SRRCFQLDRLLGIHLRPLCEHFHTIDFPISIVATGWFMTLFTNMEALSYHVVVQVFEGFI
FKGWKQLFQTALAILQDLQGPILASSFDEIPRLFFDIQDLGLWTRSTSSRNQQSSRCLIA
C
Download sequence
Identical sequences D0P4C3
PITG_21590 XP_002894850.1.21288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]