SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_00686 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_00686
Domain Number 1 Region: 211-389
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.43e-46
Family Tyrosyl-DNA phosphodiesterase TDP1 0.0000103
Further Details:      
 
Domain Number 2 Region: 31-236
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.45e-46
Family Tyrosyl-DNA phosphodiesterase TDP1 0.00013
Further Details:      
 
Weak hits

Sequence:  PITG_00686
Domain Number - Region: 690-732,760-824
Classification Level Classification E-value
Superfamily PH domain-like 0.0171
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PITG_00686
Sequence length 1123
Comment | PITT_00686 | Phytophthora infestans conserved hypothetical protein (translation) (1123 aa)
Sequence
MADDARAFKRQKLATSTDADTTPSELGFYLNRLKTAPASHNLHAKRLSDLLEGDFSRCLL
TNYMFDLPWLFTECPRLKEVPVVLVHGERDRQGMTKECRDYSNVTPVAPPLPIPYGTHHT
KMLVALYPERVRVAIFTANFLSNDWNTKTQGLWYQDFGLKVLTDSDEEEKEAVAKSSSDF
EADLVHYLSSLGAPVKLFCGELKRFDFSSARVALVPSVPGVHKGKDMEKYGHLRVRNLGS
LDEKWLFGEFAESLLPGKKHISSTSMPVQALHVIWPAVEDVRNSLEGWNSGRSIPCPLKN
MKPFLHKYLRKWMPPAELHRQNAMPHIKSYARFNASEDKAGELDWAIVTSSNLSKAAWGS
LQKNKTQFMIRSYELGVMFLPPLLGRHSNAGTSPRLVTIGSKAAEHSDVAEQPTELLPLP
VVLPTDELVRMECAATMTVADLVRTLEKRASFQKTNGVDGNRDVGSCELKDQALVVDEVE
ELDILEFQLASIDTPEWIPDRSFRRSRRISPIINSSSHKVLEAARPVSTTLLPLHQVKQD
RAFREETSTNQSTTNHPLVRFKDLIQHSQVIRSRLRTRPRNKKKRLLFTRFQAVRRNAKQ
RKNTARVLLRAGMQLIELIHLFHKDVRGLVFLLRDAILGGNTLSICELLSLVRRMVKTLT
HLNLDSSASASFLEEDNESLVRRLSWDIAGKDGGVTVILEGWVVTAEWGPFWRSQRKEYA
CLCDNHVLYFFSSRTHCADFVFELGRLRDGSVSDTSKRLMKASSSLSQIDLSETDWSVRK
SIQEEESGTVHRNAFAFFDPTGRMRLVLDVSSGAEATRWARLISAEMSQSKVFARMRELN
DEPARSSEDPDPFATWTEILTHATANANDQQSLMIPLHSLYSQMDRRNGTAREERYKSWI
LGQALKDLQRDCVKINGLVLAGASLEANILALTLEILKCTEAEQTFASKTRAGDAAMFAE
EMTALRFARQVIIYSSRTHGGGDILDALHLLFGNEKYCICPDAPSMEPIDINVSKEENSE
VPLSARITMKMTYRVIPTDSIGPMDEQADSFIQNQEADREFKIVGIYSQKYAEILLDLPN
GNTHHGFDGCVDTSEDFTTSAYSRAVEVSVELERFHGRVKSTW
Download sequence
Identical sequences D0MRF5
PITG_00686 XP_002909260.1.21288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]