SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_00923 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_00923
Domain Number 1 Region: 66-262
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0000000000000732
Family Nuclease 0.082
Further Details:      
 
Domain Number 2 Region: 304-445
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.000000000126
Family Nuclease 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PITG_00923
Sequence length 542
Comment | PITT_00923 | Phytophthora infestans conserved hypothetical protein (translation) (542 aa)
Sequence
MSASPFDDFSKGLSRAFEFIVDPFHLKKKAEKDATAPFDQPYLEPTRWFLTEEEMLRSRN
GSKREGMYLYSTGNRIKLYVASAGYFSDVADDMSTVRSGDLVYLTGWGTCNVPFKPHEPD
SKLCDLAEGAVKRGADWRMLVWSNLTERAQNHEVRDLINALPPPEKYGPARFVYDDRLPF
PTSSHHQKSVIVRKGRDLVAYVGGVDLTNDRWDTIEHDQAELRERTGIKCQWDGWLDAHA
RVEGPATKDVAQNFLDRWNAEPKPTKDLGADLLDFENPDYSNLPPVDETPLDIPQDGTHA
VQLCRTFSPDYDQYGFAPQGEQSIFHARIKAIRNAQNYIFIQDQYFILVPELLDVVMEMM
PSIERLIVIMQRTVEAEYTGYAKYLYDMVAPIQEKYPDKFKLYTTKESKQLYIHSKLVIV
DDVYVDSEIGINIVDTELVQSPDNIMVNKLARNFRIQKFMEATKLTYNELDAMTFFEACD
ALDAAAHDDGASIIEPYSVEFKPQFNLVSDGWRQVIDPDVVPEDDPAKKIKNFFNERKNA
RQ
Download sequence
Identical sequences PITG_00923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]