SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_01349 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_01349
Domain Number 1 Region: 28-97
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.24e-26
Family Chaperone J-domain 0.00025
Further Details:      
 
Domain Number 2 Region: 210-312
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000333
Family PDI-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PITG_01349
Sequence length 468
Comment | PITT_01349 | Phytophthora infestans hypothetical protein (translation) (468 aa)
Sequence
MSHSSSRVRLRLLLVLLLALAIVSVQAMDPSKDYYKVLGVNEQFSDRELKKAYRQLALQY
HPDKAENAEDKEAAKEKFVEVSEAYEVLSDSEKRKEYDDAQRFGGGAGGGFPGGFGGQGG
QRRSTDENMASFTKMFESVFGHGFGGAGGFSGGAGGFGGGFGGGFPGGAGFGGRGMPNEF
QFDGMDGFGHAKRPGARGQQQARQPTTLYGPESPVKTLSKKKFPGKAANNEWLVQFYEMD
APMAEFRGKYENVARDLNGKVRVGAVNCDKYAKLCRANGIAKFPTFAYIWEGQLTKFDGE
VDEYQVYNFAIEKHIARLQRMRNSGEIEKLHAGNEAKLCNVGKHATSGASSLCAVFVLSG
DKKKREQEMKVAKEVAKKFRHSKSLSVAYVDWKTQQLPVRKLVETAVGHSHRQQQPGLLV
IRTKRGKTRVGTHSLDADFNTDALSATMERAVGGDLSMSNVHGSVHFR
Download sequence
Identical sequences D0MVA7
PITG_01349 XP_002908020.1.21288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]