SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_01878 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_01878
Domain Number 1 Region: 85-243
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.44e-23
Family Ypt/Rab-GAP domain of gyp1p 0.0042
Further Details:      
 
Domain Number 2 Region: 222-326
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.62e-20
Family Ypt/Rab-GAP domain of gyp1p 0.015
Further Details:      
 
Domain Number 3 Region: 894-1007,1207-1306
Classification Level Classification E-value
Superfamily Fibronectin type III 3.25e-18
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 4 Region: 800-879
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000868
Family PDZ domain 0.042
Further Details:      
 
Domain Number 5 Region: 441-490,569-616
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.00000235
Family Cell cycle control phosphatase, catalytic domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PITG_01878
Sequence length 1540
Comment | PITT_01878 | Phytophthora infestans conserved hypothetical protein (translation) (1540 aa)
Sequence
MEAPCEDDASSALPTLSASCQDINTPLAAPSNIVHAPQSPSTASADVRADATAPKQSTRS
LLTLQLDREMQKRRPDHFVIGVTCRSLGGVPSNLRSQVWQELLGVARTDRPNLDQSIRQV
EEDLDNQRVVAADAARTRGNEPRFQQPETVELVVKLLTYYCKRRSIQYKQGMNEVLAPFL
LLTEQRDGAPERTPLAEGAVFQCFYALIDKLLPHVFVDKEFRSLQCSFQLYRLLMLYHDP
ALCHYLDQHDMTPELYVTPWFMTLFARSLPPEFVFYLWDFFLLEEDPYLLHFVAYALVAA
NRAKIFEADIAMLPQVLSSLTFSSRNELEQVCADALAFSELTPKSFKRDLYSVCYGGFTD
AMVPFLDQLYACSSLQVYPEELVRNLMDRLTKAKEHTSTLAPAAPVMQEEQDALNPLLSP
AEQAPLLYASGNDADEAMALKFIVLDCRPIEEYHKSHLSLSHHIDPSIMRRPAALDGLMK
GFSCMKGCHFCFVGPSVESPAVLPRPSSNNAAMNTIVRLARVISSDKSVQEQSQKPIEAH
VAEHVATSSSLPPGPATLSRKQSPGEPGALASEIGSNGASKVHAEHESVTRLVLMFLQKG
FKYVSHLDGGFDELEKTIRCMDTFTQEQLLVTSPLPPPAVTEQVTVPPETGSSSTGGFNL
FAKMGLNRPRAPSQDDFVAEVDASMRSEASDPNSGRSTSAIVSTSASVSSTPGSKEAKKK
TKATTSSAVSTLSQRLMLLKAAARDAVSSTSSSIGLSNSNTSDEVNYVEESHSTSDDGWV
EVRLKASDTVEKNAGKTTDVELQPGPIGILFQKSRTSKIFQAVVDSVVPDSQASATGLIN
TGDLLVAINGESLEGVAFLTVIEHVIEASRPVVLRFLTPVSSQRDKAATVSDIPPLAPTL
VSVTRHSICITWDKVPVSVASPAVARYQLQFAKQSGDEFNPWLPVAMKQEGTTAEVDTTG
ITDQTNGTMVGLEPGESLVFRVRCGDGQQWGPYSLSSGSMRTLNVVTAKLQSGAVTPTSV
GREDSTTAVFLAGVCPEYVERGHFFYRVLLPLHTRRRPDFNAEKLDVVLEKGLVIRGSER
LVCPGTNQIFVRVALGNTDDNVDQDGEYEGADGELMLLRNGQREADDDADGVWAFENTPD
GAVVLERLPESAGEETGPSLQEQAKSMVQSFLSSSGISPGLGDNVNSNSAGSISSMVSTA
ASSSGSNSAPPSAHTLTAPRILQVFAASSSEVVVTWDPVSDVGVTKFQIQYVKDRLAAMW
WTVKPDVEADTLKFTVSGLQPNTPYLFRLRSGTEDNKWSPYSESSESCRTPPTDRGSANN
SSDEDERKPTSSDGKKAQQTTTQAPQSASMSTGSTILDKAVAVASRLRRRSNSSNNHQPC
DETPLSKEEDETEQLEDNTKSEASARYVNLTSWKSSSNNADKSFHFYSATKFEEQDEEAH
RQLSELGHRELVVTSSALVVLIVKASTPKGFALVEEWRPLTSLTKVESRNDLDNSLVFHF
KSQVEASAERSDQLLFAVDGAKDCAKVVEDYLATVKLEGK
Download sequence
Identical sequences D0MUB2
PITG_01878 XP_002908476.1.21288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]