SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_02503 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_02503
Domain Number 1 Region: 25-72,122-236
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.49e-32
Family PAPS reductase-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PITG_02503
Sequence length 291
Comment | PITT_02503 | Phytophthora infestans conserved hypothetical protein (translation) (291 aa)
Sequence
MTNDSSMRSILLRFDLFFAGADAAMQKRLQKALDVMRSAIDIFGLEGVCFSFNGGKDSTV
VLHLLRIVVAKRVLEEAQLAHLKAEQEAENGPKTTVTSPRNSFVSADLLQEEELEARVKT
QLQRVPVMYFDSYDQFPEVREFTEECNTKFALSCHVYKCSFVEGVKDILDKLQVKGIYMG
VRGGDPYTEDMEHFSPSSPGWPPFLRVNPILKWTYDDVWSFLRDCQLEYCSLYDHGYTSL
GNIFDTVQNPELWRTGEDGKEGYYLPAYELKDGSSERCGRQKKAHTTSKSE
Download sequence
Identical sequences D0MWH8
PITG_02503 XP_002907427.1.21288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]