SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_03752 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_03752
Domain Number 1 Region: 33-87
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00000288
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PITG_03752
Sequence length 108
Comment | PITT_03752 | Phytophthora infestans hypothetical protein (translation) (108 aa)
Sequence
MALSRNFRTTYYKTLGVPVVQHIVDVDASFAALLSERAVNVPQLLKLALELGIAPQYRSR
IWLLLLGVLPPYPGIWSFALKERRDMFEDVVGAAQVFQTKDATEEKTR
Download sequence
Identical sequences D0MYF1
PITG_03752 XP_002906798.1.21288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]