SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_03831 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_03831
Domain Number 1 Region: 92-214
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.92e-20
Family Ypt/Rab-GAP domain of gyp1p 0.012
Further Details:      
 
Domain Number 2 Region: 261-347
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000342
Family Ankyrin repeat 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PITG_03831
Sequence length 397
Comment | PITT_03831 | Phytophthora infestans conserved hypothetical protein (translation) (397 aa)
Sequence
MVPAELVSISTPLPNARRRHHSNCDLCEAESPGEVQMDVVPEKKRQLFWRNVVKQFNFTD
QSERELLLSLTGGISWTHMRMLPKDFMRRHREIYYLISTPEYERSGAIGRDVTRTFSIFE
RSHQHQLAAQQSALFRVLNAIAEAEDGYCQGMNFIAALFLVEGLSEADAYALFLYMLKKR
HLAGIYHRSSTFLDEYLQHFELMFIRDLPKLHAHMLAQGFAIPISDAGASSSDSSSADGE
EESASTLSGFGLHRTLSPDLADAIRSGNGTLVRQLFEDHVVRRHHSSTASVVLANEILHF
AIWYGRVSVACLAIERCNADVDNRDDSGLTPLHFSVIRNQPDMETSMRKLSPLELAHRWK
RRDTTAARLVLEKEELASVPSLTSNVVAGITSLRDKV
Download sequence
Identical sequences D0MYM6
XP_002906873.1.21288 PITG_03831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]