SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_05516 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_05516
Domain Number 1 Region: 187-340
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 7.24e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 23-75,137-173
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000448
Family Glutathione S-transferase (GST), N-terminal domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PITG_05516
Sequence length 354
Comment | PITT_05516 | Phytophthora infestans hypothetical protein similar to /K21C13_21 (translation) (354 aa)
Sequence
MTTKNTWAVSEKGTFVRDPSKFRNWIEPNADAEFPAEANRYHLYVSLACPWAHRTLITLY
VKGLQGAIGLSIVHPVFQRTRPNDPEDQHMSWAFADPKKTPWLAGPSGHGQYSSDGAIPD
TINNAQYVRDLYEMCSEGNTRYTVPVLWDKVKKTIVSNESADIIRMLNSSFDGIVPSKVD
LYPAKYREQINEVNEWVYNNINNGVYKCGFSSSQGAYDEAVNKLFDSLDRVEEILSKQRF
LMGDVFTEADVRLFTTLIRFDEVYHVHFKTNKKMIKEYPNLLNYTRDIFQFPPVVKSIDS
KILMQHIKFHYYGSHTHLNTFGIVPTGPNTDLSAKHDRDRFQSATLPEFSINSN
Download sequence
Identical sequences D0N305
XP_002999151.1.21288 PITG_05516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]