SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_07971 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_07971
Domain Number 1 Region: 346-474
Classification Level Classification E-value
Superfamily Chaperone J-domain 5.5e-25
Family Chaperone J-domain 0.00015
Further Details:      
 
Domain Number 2 Region: 9-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000765
Family Ubiquitin-related 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PITG_07971
Sequence length 478
Comment | PITT_07971 | Phytophthora infestans conserved hypothetical protein (translation) (478 aa)
Sequence
MEGGIWAFYYLQGEDGEDRSHPNAFKLTGVSSGADVTLADVLRSFPLRNPAAFHFRFRLN
SSKSNTFYWLDVTQPTQKVPLAGGRVICKLLRLERPKKPGLVFRRRPVLKWASGSQPPKR
QGSSSALGDSSNSVQSVKSVQPLGEGNNFHRSSSSQGFEQGRPAKYSDRTPGSGSGADSR
HSNASSRTSSISGDKKPVSRTGSGSKPAAPEAQGNLEDFLSGSQKVPSAGAAPSSSPPKK
DVNLMSDSGWNDAPATPAQPANATSDFLNAMDPLATRSAPSQPSPSKTVLRDPPKFDDDN
GQTVGPVTMAEMEAHSKSTSDGSNVYNPNLVDKSTKSDDVRRAMEERERQVQRDVERARD
DLRKREEAVRNMAAMKDSASTVLGPRLKAWAEDNGRVKNIRTLLSTMHQVMWEGCKWTEV
NMGKLIQPNDIKKHYRKAMIVVHPDKAGGRNAEQLLIAERVFAALNTAWEDFQKTNPC
Download sequence
Identical sequences D0N965
XP_002904175.1.21288 PITG_07971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]