SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_09722 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_09722
Domain Number 1 Region: 159-269
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.78e-33
Family Thioltransferase 0.00067
Further Details:      
 
Domain Number 2 Region: 21-132
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.19e-29
Family Thioltransferase 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PITG_09722
Sequence length 271
Comment | PITT_09722 | Phytophthora infestans thioredoxin H-type (translation) (271 aa)
Sequence
MMLQGFWNWFRKNVLGQENETIPENSRVIHVTSEQQFQELIGKGKSTKRSVVVDFSATWC
GPCRHISPVYHELSAKYPCTIFLKVDVDELKPVSRGCGVTAMPTFQFFRSGVKCDEMRGA
DRNGLETLIQKHYVEVELPENEKSIVASEEKTSDEGLRQRKPQVTNVTSEEQWENLMQQN
QESNKALVVDFWATWCKPCVEIAPFFEELSARFPSAVFARVDVDELESVAEDFNVSSLPS
FKVFKGGKVVDELSGAIRSALESMIAKHAKN
Download sequence
Identical sequences D0NCN3
PITG_09722 XP_002903323.1.21288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]