SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_10572 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_10572
Domain Number 1 Region: 82-218
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.14e-22
Family Nuclease 0.023
Further Details:      
 
Domain Number 2 Region: 6-40
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0000261
Family Nuclease 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PITG_10572
Sequence length 299
Comment | PITT_10572 | Phytophthora infestans conserved hypothetical protein (translation) (299 aa)
Sequence
MNSLGAYKGWLDGHVRIHGPAAKDVAANFLARWNSDYKPTQSLAHDLLDFENPSYSDLAP
LNYASSKTSSTLGRQSVQIVRTFSCQYKRYNEFAPRGENSLFQARIKALKNAKNFIYIED
QYFILVPELLNALLEVMPTIQRLIVKYLFDMIAPIQKLYPNKLQIFSTKKELNLYIHSKV
VIIDDVYLSVGSANWNRRSMTSDSELGANIIDDETVQSPDGTTVLKAARDFRIRKFQEMT
GLSYEKLNAMTFIEAANQFDEAAVGKSSIIEPYQVKEQAYFTAVNEVVRKTVDPQDTCM
Download sequence
Identical sequences PITG_10572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]