SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_10726 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_10726
Domain Number 1 Region: 1-41,74-142
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000026
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 
Domain Number 2 Region: 271-381
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000446
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 3 Region: 667-753
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00000000017
Family Ypt/Rab-GAP domain of gyp1p 0.022
Further Details:      
 
Domain Number 4 Region: 492-644
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000000191
Family Ypt/Rab-GAP domain of gyp1p 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PITG_10726
Sequence length 876
Comment | PITT_10726 | Phytophthora infestans hypothetical protein (translation) (876 aa)
Sequence
MEGVLWTREGRSKLLRGWHKRYFVLSETGTLREYSSDVSKKELLSRARRASSGASTTSST
SSPDRSNCNSGMTLRREVDVRGAAVKTLPFPLVGKHNAFQVTIAPISQIMGTPQQKLVLS
ARQADDVRQWMNALRSAALKLTIPRRPSPMGWSRGSDSRGEMGNEEESDFVEVKMPQRAD
MAHLSSVYEWIHECCVKTAQNLTVAGVDIPRGSLLVSANGVSLQTLTSVEVRKLLLESTG
TLPVSLRFLRSPAKCGVLRAKLYTSPLTQLKSLAKYRKSSRMDWKEQVVDLSGDLLTCQL
KVKTPLAIGNSSSNSSNSKTKRVLVLSSGSSVKPVHELVSDRKYCFMVTVQAHSMLFQAR
CEVDRRAWTDAIQRAITIAEGLVPGGALARGSFDLDALQLQSSMNMRHLEQEFEGMEGGD
GIDYDDEEDESDGGLEDELSPVDASARLPLPKDWISATQSAAYLPDKELTEMLRVLQSSG
RFVEALQLMEKNTTLRVIYWQQIFRWALVPAQSGEESLELFQQLAQTPLSEEDDSQVQKD
IPRTAKWLAGSAGAPELDDTERAVRLERLERVLHAFLSSCSLDVRTDEEPVSPSSAGSSS
SSSSFYMQGMNGLAFILLEVLENDEVEAFRFLRGIVARILPHVFGICCEGTGRDHFDLFR
SLVEVGDVLQEVARLHLPSFHAALERAGLPVCLLAYKWFPTLFSDVTLTASHSQLRFDTL
LCCWDVCLLLGLEGMFCVALALCSAAEDDVLALAGCGDAACNSAEQVSATVGRSLALLTP
EDLITSVCEVLELCSHPVLLKLRNAHRRRLKLGYSKVGNGFAARSSPDRTVAKRPDVVPP
PMTVTDLDSGKMRTNTGVVSFVQSHTVLHVVLSGMS
Download sequence
Identical sequences D0NGY0
XP_002901563.1.21288 PITG_10726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]