SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_12138 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_12138
Domain Number 1 Region: 121-168
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000208
Family Ovomucoid domain III-like 0.0055
Further Details:      
 
Domain Number 2 Region: 179-217
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000152
Family Ovomucoid domain III-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PITG_12138
Sequence length 420
Comment | PITT_12138 | Phytophthora infestans predicted protein (translation) (420 aa)
Sequence
MKLAVGLVLAAVAAVAVSAGDPATLSTKEEATKTTKTTKSEKTGTAPSSGIGSLFADGSN
GVIGDESAAGVKTDPKLLKSIGIMGKDGSGGLNLGPGPAVYPSDSGSWDWSWDSIEGSGS
SHYDCDTECPDDFNPVCGSDHVTYTNDCAFTVAQCNATELVVANSGECAKSSSGSNAESC
PDACTMEYSPVTDENGKKYSNECAMRLAKCKGEAGEEKKIVTFAALDETTDEKGAKETPA
PASKTTKATKSEKTGTASGSGIGALFEDGSNGVIGSEDKSGSADPTLVKGTKETPAPASK
ITKATKAEKTGTASGSGIGALFEDGSNGVIGSEDKSGSADPTLVKGTKETPAPASKTTKA
TKSEKTGTASGSGIGALFEDGSNGVIGSESASADPTSVKGVKPVAEKTVPQRLRRLCRKF
Download sequence
Identical sequences D0NJ47
PITG_12138 XP_002900758.1.21288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]