SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_12809 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_12809
Domain Number 1 Region: 250-387
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.86e-19
Family Nuclease 0.028
Further Details:      
 
Domain Number 2 Region: 160-194
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0000135
Family Nuclease 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PITG_12809
Sequence length 472
Comment | PITT_12809 | Phytophthora infestans conserved hypothetical protein (translation) (472 aa)
Sequence
MSRGVQSRTTPTTTRTGVECTKVGGFFSAVVRLCICEPCHVCEFKKNSLTCGYKEHKELD
ASDGSDLTVDQPLLAPTDWFLTKEEITASRNGSTRGDMATYTTGNDVTTYTVTKEFFDAA
FTDLSSTKEGDRVMLTGWGRWDTIYHNESELRESTGVSGSFKGWIDGHVRIHGPAAKDVA
GNFLSRWNSDYEPTQGLAKDLLEFDNPPYDDLAPLDYTSSRTKSELGSQNVQIVRTFSCK
YEHYDEFAPYGENSLFQARIKALLSAKNFIYIEDQYFILVPELLEAILQVMPTIQRLIVV
VQRPVGRSKFSGYEKYMFEMTAPIQKLYPNKFQIYTTKEELDLYIHSKVVVIDDVYLSVG
SANWNRRSMTSDSELAANIIDDETVESPDGIAVLKAARDFRIRKFQEMTGRSYEELDAMP
FIEAANQFDVVAADNSSIIETYEVKRQTYFTAVTDAVRKKVDPQDTCTEPEK
Download sequence
Identical sequences PITG_12809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]