SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_18317 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_18317
Domain Number 1 Region: 126-281
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.27e-57
Family Glutathione peroxidase-like 0.00023
Further Details:      
 
Domain Number 2 Region: 7-118
Classification Level Classification E-value
Superfamily PH domain-like 0.0000506
Family Pleckstrin-homology domain (PH domain) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PITG_18317
Sequence length 288
Comment | PITT_18317 | Phytophthora infestans conserved hypothetical protein (translation) (288 aa)
Sequence
MSTENKTEGVIQAGNLHRKRAGLFAKLTGGKQHVYVEANDKQKHVTVFESETNKATPLAT
VDVSSDATVEFDASMTHGIKLANPKITEIFSAESKEKQEEWLNSFINAGAQYREVFNVED
TAKIKSFYELKDFDMAGNEVSMSKYKGKVVLAVNVSSKCGLTPTNYPELQTLYEKYKEEG
LEVLAFPCNQFAGQEPGTHEEIMEFVKQYNVTFPFFEKHDVNGATARPVFTYLKTKLPGS
FGDFVKWNFTKFLVDRNGQPYKRFAPKDRPLSFEEEIKTLLAQKATEE
Download sequence
Identical sequences D0NXV6
PITG_18317 XP_002997769.1.21288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]