SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_19150 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_19150
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.02e-18
Family Ypt/Rab-GAP domain of gyp1p 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PITG_19150
Sequence length 374
Comment | PITT_19150 | Phytophthora infestans predicted protein (translation) (374 aa)
Sequence
MIGLHTDCAVMNTLLRQNDVELHSHLNELGLNMEILCTKWLVTCFLTSLPTFCGLKVIDM
LLARSKEKQRASRVLLGVGISIFFTLRETLLDAKDAGEVLLAINEYFAREMTKTTVEMDK
FLHFCLIITDQLEPDIVEEFRLVHKDEVMERFAAFEAKKIEMRQQLEEAKAKQRKVASAP
PSPSKTERLSTLSASGIASGKSNGNNRISGLSSYISNPLRSSGGSKTTGAGDDKESHKRY
QRVDVLQAHHSFSEDLEKMEDQLEDLADLFVRGKIDEKEHSCIRAQIVRKWCKGMNSPQS
AMVRVQCVKHTYCERSGGDGCTNSAPGLLEGPVRNSFTGEAEGAHRGRKGSISLYGRMKK
AQKSALAIFKSTFE
Download sequence
Identical sequences D0NYY6
XP_002997461.1.21288 PITG_19150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]