SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_20603 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_20603
Domain Number 1 Region: 199-334
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.16e-20
Family Nuclease 0.017
Further Details:      
 
Domain Number 2 Region: 53-140
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0000000166
Family Polyphosphate kinase C-terminal domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PITG_20603
Sequence length 419
Comment | PITT_20603 | Phytophthora infestans predicted protein (translation) (419 aa)
Sequence
MVKRGTNVNILNWSNIGYKIFATKARDLINKIPPSPINGAKAVFLFDDRVPTIASAYHQK
TLVITLNSSSDIDYQPVAYVGGLDLAKERWDTIYHNNSALRDASGITFKRKGWIDGHIRI
HGPAARDVANNFVARWNSDYLPSQGLVDDLLGFENPPYEDIPRISYASNTGSPGNQSIQI
TRTFSCKYKHYKEFAPRGENTLFHARIKAIKNAKNFIYIEDQYFIYVPELLDAIMEVMPK
IQRLVVIANPETNPISKGGYVKYLYEMVSPIREKYPNKFKMYTVKGDLDLIIHTKVVIID
DVYLSVGSANWNRRSMTSDPELNAEVVDGDTVKSPEGVTVGKLPRDFRIRKLVEMTRLSY
EELDAMTFIEATDQLALAAIDESTILDNLDIKHHAYFFAITDTIRKISDPQDTCAYNSR
Download sequence
Identical sequences PITG_20603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]