SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPAC3G6_01.1 from Schizosaccharomyces pombe 972h-

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPAC3G6_01.1
Domain Number 1 Region: 594-890
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.93e-68
Family Tandem AAA-ATPase domain 0.0000328
Further Details:      
 
Domain Number 2 Region: 359-592
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.95e-55
Family Tandem AAA-ATPase domain 0.0000973
Further Details:      
 
Domain Number 3 Region: 187-253
Classification Level Classification E-value
Superfamily Chromo domain-like 1.35e-17
Family Chromo domain 0.00064
Further Details:      
 
Domain Number 4 Region: 266-340
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000000196
Family Chromo domain 0.0022
Further Details:      
 
Weak hits

Sequence:  SPAC3G6_01.1
Domain Number - Region: 1122-1156
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00515
Family Homeodomain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPAC3G6_01.1
Sequence length 1388
Comment | SPAC3G6_01 | Schizosaccharomyces pombe 972h- ATP-dependent DNA helicase Hrp3 (1389 aa)
Sequence
MSTSAIALALSSSKAIEQLDHVQTETPNLKQEMSESPSNSGVASKRKLQSTEWLDPELYG
LRRSGRTRSNPGRYVDTDDQEDVFPSKHRKGTRNGSSFSRHRTIRDLDDEAESVTSEESE
SDDSSYGGTPKKRSRQKKSNTYVQDEIRFSSRNSKGVNYNEDAYFESFEEEEEEEMYEYA
TEVSEEPEDTRAIDVVLDHRLIEGHDGSTPSEDYEFLIKWVNFSHLHCTWEPYNNISMIR
GSKKVDNHIKQVILLDREIREDPTTTREDIEAMDIEKERKRENYEEYKQVDRIVAKHLNS
DGSVEYLVKWKQLLYDFCTWEASSIIEPIAATEIQAFQEREESALSPSRGTNYGNSRPKY
RKLEQQPSYITGGELRDFQLTGVNWMAYLWHKNENGILADEMGLGKTVQTVAFLSYLAHS
LRQHGPFLVVVPLSTVPAWQETLALWASDMNCISYLGNTTSRQVIRDYEFYVDGTQKIKF
NLLLTTYEYVLKDRSVLSNIKWQYMAIDEAHRLKNSESSLYEALSQFKNSNRLLITGTPL
QNNIRELAALVDFLMPGKFEIREEINLEAPDEEQEAYIRSLQEHLQPYILRRLKKDVEKS
LPSKSERILRVELSDLQMYWYKNILTRNYRVLTQSISSGSQISLLNIVVELKKASNHPYL
FDGVEESWMQKINSQGRRDEVLKGLIMNSGKMVLLDKLLSRLRRDGHRVLIFSQMVRMLD
ILGDYLSLRGYPHQRLDGTVPAAVRRTSIDHFNAPNSPDFVFLLSTRAGGLGINLMTADT
VIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLLSKDTIEEDVLERARRKMILEYAIIS
LGVTDKQKNSKNDKFSAEELSAILKFGASNMFKAENNQKKLEDMNLDEILEHAEDHDTSN
DVGGASMGGEEFLKQFEVTDYKADVSWDDIIPLTEREKFEEEDRLREEEEALKQEIELSS
RRGNRPYPSSAVESPSYSGTSERKSKKQMLKDEVLLEKEIRLLYRAMIRYGSLEHRYNDI
VKYADLTTQDAHVIKKIAADLVTASRKAVSAAEKDLSNDQSNNKSSRKALLITFKGVKNI
NAETLVQRLNDLDILYDAMPTSGYSNFQIPMHVRSVHGWSCQWGPREDSMLLSGICKHGF
GAWLEIRDDPELKMKDKIFLEDTKQTDNSVPKDKENKEKKVPSAVHLVRRGEYLLSALRE
HHQNFGIKSSPAISTNGKTQPKKQTANRRQSGKPNVKSAQKIESATRTPSPAISESRKKP
SSKDTKIETPSREQSRSQTASPVKSEKDDGNVSLNAEQKARCKELMYPVRKHMKRLRKDS
SGLGRAELVKLLTECLTTIGKHIEKTVNDTPSEEKATVRKNLWMFACYFWPKEEVKYTSL
ISMYEKMK
Download sequence
Identical sequences O14139
SPAC3G6_01.1 NP_594967.1.19918 4896.SPAC3G6.01-1 SPAC3G6.01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]