SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPAC4G9_11c.1 from Schizosaccharomyces pombe 972h-

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPAC4G9_11c.1
Domain Number 1 Region: 139-219
Classification Level Classification E-value
Superfamily HMG-box 1.28e-16
Family HMG-box 0.0012
Further Details:      
 
Weak hits

Sequence:  SPAC4G9_11c.1
Domain Number - Region: 70-117
Classification Level Classification E-value
Superfamily HMG-box 0.00586
Family HMG-box 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPAC4G9_11c.1
Sequence length 223
Comment | SPAC4G9_11c | Schizosaccharomyces pombe 972h- cytosine-mismatch binding protein 1 (224 aa)
Sequence
MRLFDAMPPYLTYQAPLSLIIFHKMVFAIRIRQFHTTLVSAEKNGLQKLIPPRLKTIWNQ
MLVETKGAGNGPERFEMIRQKYKALTADEIQKYKNKLQEQFDAEKKRFMETLRSFTPTEI
DSENRRRSKEAHSTGSRYYRLRHPDVPKKPSSAFILFYKELRNNPKLRQELGIPEAISTL
VEETQNASKAWKELAEDKKKPFIDKSKALKEQYDKFMKEAGFR
Download sequence
Identical sequences Q10241
4896.SPAC4G9.11c-1 SPAC4G9_11c.1 NP_593693.1.19918 SPAC4G9.11c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]