SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPAC57A10_09c.1 from Schizosaccharomyces pombe 972h-

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPAC57A10_09c.1
Domain Number 1 Region: 8-88
Classification Level Classification E-value
Superfamily HMG-box 9.69e-28
Family HMG-box 0.0000791
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPAC57A10_09c.1
Sequence length 108
Comment | SPAC57A10_09c | Schizosaccharomyces pombe 972h- High-mobility group non-histone chromatin protein (109 aa)
Sequence
MPRAAKSSRKKDPNTPKRNMSAFMFFSIENREKMKTDNPDATFGQLGSLLGKRWKELTST
EREPYEEKARQDKERYERERKEYDTKLANGEKTGKASAPAAAAAAKEE
Download sequence
Identical sequences P87057
SPAC57A10_09c.1 NP_593314.1.19918 4896.SPAC57A10.09c-1 SPAC57A10.09c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]