SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPAC644_12.1 from Schizosaccharomyces pombe 972h-

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPAC644_12.1
Domain Number 1 Region: 36-108
Classification Level Classification E-value
Superfamily Homeodomain-like 2.47e-19
Family Myb/SANT domain 0.025
Further Details:      
 
Domain Number 2 Region: 5-49
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000358
Family Myb/SANT domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPAC644_12.1
Sequence length 757
Comment | SPAC644_12 | Schizosaccharomyces pombe 972h- cell division control protein Cdc5 (758 aa)
Sequence
MVVLKGGAWKNTEDEILKAAVSKYGKNQWARISSLLVRKTPKQCKARWYEWIDPSIKKTE
WSREEDEKLLHLAKLLPTQWRTIAPIVGRTATQCLERYQKLLDDLEAKENEQLGLISGEG
AEAAAPVNDPNSRLRFGEAEPNLETLPALPDAIDMDEDEKEMLSEARARLANTQGKKAKR
KDREKQLELTRRLSHLQKRRELKAAGINIKLFRRKKNEMDYNASIPFEKKPAIGFYDTSE
EDRQNFREKREADQKIIENGIRNNEMESEGRKFGHFEKPKPIDRVKKPNKDAQEEKMRRL
AEAEQMSKRRKLNLPSPTVSQDELDKVVKLGFAGDRARAMTDTTPDANYSTNLLGKYTQI
ERATPLRTPISGELEGREDSVTIEVRNQLMRNREQSSLLGQESIPLQPGGTGYTGVTPSH
AANGSALAAPQATPFRTPRDTFSINAAAERAGRLASERENKIRLKALRELLAKLPKPKND
YELMEPRFADETDVEATVGVLEEDATDRERRIQERIAEKERLAKARRSQVIQRDLIRPSV
TQPEKWKRSLENEDPTANVLLKEMIALISSDAINYPFGNSKVKGTANKVPDLSNEEIERC
RLLLKKEIGQLESDDYIQFEKEFLETYSALHNTSSLLPGLVIYEEDDEDVEAAEKFYTND
IQRDLAKKALECNKLENRVYDLVRSSYEQRNFLIKKISHAWKALQTERKNLTCYEFLYNQ
ERLALPNRLEAAEIELSKMQQIEAYAQQDYARVTGQN
Download sequence
Identical sequences P39964
SPAC644_12.1 NP_593880.1.19918 SPAC644.12 4896.SPAC644.12-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]