SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPAC6B12_06c.1 from Schizosaccharomyces pombe 972h-

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  SPAC6B12_06c.1
Domain Number - Region: 45-98
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0197
Family Centromere-binding 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPAC6B12_06c.1
Sequence length 117
Comment | SPAC6B12_06c | Schizosaccharomyces pombe 972h- conserved fungal protein (118 aa)
Sequence
MNIFNYTTLIFRRLSSTFKASNKASIEWKKQNIAVKRKIGGYWNPKKKLPLESMDEIRRL
KKEKSSMSCSELAKLYGVSPESIRRILKSSNRPLDDREKSRKEKRWLNSLKSNRDFA
Download sequence
Identical sequences O14211
SPAC6B12.06c 4896.SPAC6B12.06c-1 SPAC6B12_06c.1 NP_593761.2.19918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]