SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPBC14F5_12c.1 from Schizosaccharomyces pombe 972h-

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPBC14F5_12c.1
Domain Number 1 Region: 2-75
Classification Level Classification E-value
Superfamily Homeodomain-like 5.91e-23
Family Centromere-binding 0.0026
Further Details:      
 
Domain Number 2 Region: 77-138
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000296
Family Centromere-binding 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPBC14F5_12c.1
Sequence length 514
Comment | SPBC14F5_12c | Schizosaccharomyces pombe 972h- centromere binding protein Cbh2 (515 aa)
Sequence
MPPLRRQALTLAEKKAIRKHYFESATKPSQQELISWFEEHFHKKLAQSTVSSILSSKNEF
LDNLDAENSQIRRNRQGKYPILENALIDWQTRLQKQDGAITGNAIKKSAAELWRRIPEYS
ELPIPEFSNGWLEKFKKRCLKHGLKLQGESTSVNQGTYEENMVQIQELISLFDPKDIFNM
DETGLCWKLIPNQSPASERVKGITRDKARVTVTICCNATGSEKAPLWVIGYAKSPRAFRQ
ANAHPDSMDFHWRYNGTARMTTSIMEEWLRWFDDLMKGRKVLLILDKFVAHECALENIRN
SERKLVNTTVVFLPVNSTEIYHPCGQEIVYAFKSYYRKYWLNYMLEEIRLGKNPSKTMNV
LKAVRWMIRSWNVDFEPSIIYNCFLRSGLFQNQQPLTGPSPETIRIAVNLQELIGKYLGD
KDIFQIENFINPIEENSADTNDDIVNQVAAQFLDEREFETDEEEEESQYLLSTKDAINAI
NTLLNFQEQSEDGNVLFTRTLLQFQKVLESRSIV
Download sequence
Identical sequences O60108
4896.SPBC14F5.12c-1 SPBC14F5_12c.1 SPBC14F5.12c NP_596738.1.19918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]