SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPAC10F6_08c.1 from Schizosaccharomyces pombe 972h-

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPAC10F6_08c.1
Domain Number 1 Region: 199-254
Classification Level Classification E-value
Superfamily HMG-box 0.0000000785
Family HMG-box 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPAC10F6_08c.1
Sequence length 341
Comment | SPAC10F6_08c | Schizosaccharomyces pombe 972h- HMG box protein (342 aa)
Sequence
MENPPYHVSISKSEEIKYRQKCKDLKARIQEIQKGNQELLSKYEVIRRAVKRGRLERAIL
MEQLELQSEAKSREFGQRSEPSPPPPPEGIKIKISTKGAGNPSAKKLKISTEETSDTNVA
LNNTSEISHKSSNNSQPKDASVNDTDADFEQQNQVVQSKDEKITNTDPIPSPIITNLKTE
SSKSSGAKKATSNAKITDTMLFNHFSSIQKPKLKAEGSTLKGQALKKTLEDTWNNLTEEE
KKPYHEGLLAAREKAREARRRRSAQNSAKLEKEKAKEKQKDKDQEQDTVSDKNQIDEIEK
GQKEVDEEPVSEPTTSPILPPKNQEPIRMGGFTVVNRSSNA
Download sequence
Identical sequences O42648
SPAC10F6_08c.1 4896.SPAC10F6.08c-1 NP_593259.1.19918 SPAC10F6.08c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]