SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPAC13F5_05.1 from Schizosaccharomyces pombe 972h-

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPAC13F5_05.1
Domain Number 1 Region: 27-141
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.01e-28
Family PDI-like 0.0063
Further Details:      
 
Weak hits

Sequence:  SPAC13F5_05.1
Domain Number - Region: 151-248
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0245
Family Thioltransferase 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPAC13F5_05.1
Sequence length 363
Comment | SPAC13F5_05 | Schizosaccharomyces pombe 972h- thioredoxin family protein (364 aa)
Sequence
MLFRIPTLFTLFLACFSLVSGVFGYSPMFGSNTIELNSKNFRKFVKAKGPSLVVFYAPWC
GYCKKLVPTYQKLASNLHSLLPVTAVDCDADQNRAVCSQYQVQGFPTIKLVYPSSKGSSL
SSTDYNGDRSYKSLQKFVSDSIPSKVKILTSEAKTQKFIQDAQNSSKVILISQKMKPTLL
YKSLSNEFSSLPFSFMPAKANVNDLFNISAYVDTSDLPILFIKHPNNGTSFFSNSLNRDS
IVEFLQSSIKDNNFSEYLATFCSKKSCIITIQDKDSDSGIDESIRKKYPKLHFVRLGRNT
TVAERLEDTLDLGYSDTFLLSLKKSHYNAKPYGKPLRRWLEDIQVQQAGPSVSLPNDLLS
KIK
Download sequence
Identical sequences O13704
SPAC13F5_05.1 SPAC13F5.05 4896.SPAC13F5.05-1 NP_593653.1.19918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]