SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPAC17G6_10.1 from Schizosaccharomyces pombe 972h-

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPAC17G6_10.1
Domain Number 1 Region: 48-154
Classification Level Classification E-value
Superfamily Homeodomain-like 1.25e-32
Family SWIRM domain 0.00011
Further Details:      
 
Domain Number 2 Region: 291-335
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000445
Family Homeodomain 0.067
Further Details:      
 
Weak hits

Sequence:  SPAC17G6_10.1
Domain Number - Region: 220-267
Classification Level Classification E-value
Superfamily RING/U-box 0.0494
Family ZZ domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPAC17G6_10.1
Sequence length 527
Comment | SPAC17G6_10 | Schizosaccharomyces pombe 972h- SWI/SNF and RSC complex subunit Ssr1 (528 aa)
Sequence
MSNVTENKHDLHENGVPDSAQPMELDVSKKEDTEPEVRDEAKEFLLSQLPQVEVPEWAQW
FDFSKVHEIEKKQNPEFFDGKNTSKTPEVYKEYRDFMISTFRLNSKVYLTFTACRRNLAG
DVCAVLRVHRFLEQWGLINYNVNPDTRPSKIGPPSTSHFQILADTPRGLVPLLPPPSSSI
PRSKAVTIEDPSIVRTNIYDPSLDDVLKGKGSTPNQKPSLSNLHENNIDQSDSPQHCYCC
GNKFNESYYQSQTAQKYNVCISCYQQNRFPSPTTIADYKEVAIQNKIEDDDTWTAQELVL
LSEGVEMYSDDWAKVASHVNTKSVEECILKFLNLPSSDKALFKMDKVHTNPVVDSLQGKN
PILSVVSFLAKMVPPSSFTQKSSAKEEESDKVKGESVYPKPESESYDVEMNGKSLEDSDS
LSELYLTNEEKKMASIIKDSVNVQIKLIESKLSHFDYLDQHIRLKSQELDAFAQATYREK
LYMKRECQNARKKIEQQLQSKDTAANGLPVQSSAETSVIPASSMSPS
Download sequence
Identical sequences O13788
NP_594257.1.19918 SPAC17G6.10 SPAC17G6_10.1 4896.SPAC17G6.10-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]