SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPAC23E2_02.1 from Schizosaccharomyces pombe 972h-

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPAC23E2_02.1
Domain Number 1 Region: 505-565,603-875,997-1037
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.05e-34
Family FAD-linked reductases, N-terminal domain 0.023
Further Details:      
 
Domain Number 2 Region: 392-486
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000349
Family SWIRM domain 0.028
Further Details:      
 
Domain Number 3 Region: 1109-1203
Classification Level Classification E-value
Superfamily HMG-box 0.00000012
Family HMG-box 0.0047
Further Details:      
 
Weak hits

Sequence:  SPAC23E2_02.1
Domain Number - Region: 861-970
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000204
Family L-aminoacid/polyamine oxidase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPAC23E2_02.1
Sequence length 1273
Comment | SPAC23E2_02 | Schizosaccharomyces pombe 972h- histone demethylase SWIRM2 (predicted) (1274 aa)
Sequence
MPLGRSSWICCAKYFVNTKSRFNEILPPRFTLIVSFYSMNTSENDPDGHYDFPEMTEHHS
DRASSYANANNVNSTQPQLVSSEQALLAILGGGLQSITPNSVNQNAYSRSTYRTDGGLNS
QPVSSLNNQWGNYNPAFLPSRYDSSFHPYTISQAANQPFPQHLLGNSNAGVAQQSGMRTI
GLPPTVGSSFPQQKSSTYENFFDANSPSSQQFPSTYPSRSQNPLSSSGDGSTAIHAGPIQ
HQNSNAFSNYPYPLDASHLSSQQLLSMYRDQVSHGVTPSTFRNHESFMPTQLVSATELSK
SVDNAVLPIPPTTAPAVVSPPASSFPLMSSAATSGNISSPALFDSELGARPEGSVAIEPS
RVLLQWSSQSSSHTIPSAGASIPTSSLKSFFEHAAEAARKCNLDPRALESFEQHMLSDRL
HDPVVLFHYFQIRNSICWLWIKNPTHAISRVEAQGVCVDRCLFQLASLAYEFLVRYGYIN
YGCLSFDSSFTNETNTGTTSSSASKQKTIAVVGAGLTGLICARQLTGLFSQYSSSFLSKN
ELPPKVIILEAKERTGGRIYSRALPVSHTSATQINHHTSNSNSISSNSTSLNPKDVTDPS
HIPSAIDLGFQFLFSPMDDILLNLLNKQLGIEVTEMTGSDLVYDETDTKVLDMVEVKKLN
ILWEKLLEYVSVCFFINVEESVRISWISQFQLFIDEMFPDHLSKSLSLNASHEFSFKKTM
LILIDEVSSYAKLGNSQKKFLIWCFKVAELDDTLYPLNTVDTDFSKDILIPKVARRGLSQ
LPWALQSYPSPLNIHYEKFVSKVTIENDKCTLDCKDNSSYEVDQVVIACSPSHFSSNIEF
SPGLPNFVTENIKSIDFKPGKKVILRYAAAFWRKNIRSFGIIPKSLSQEMNNDENDGKSC
FVLRIWNMLPETGVPILVADINPQMTSSSSNETSHLIQELHSLIVDHFQNDSNSSADLLD
AWVTNWSRNGVYDGLNSYPNFANDKQQYEKRFRQSQLSYNLGRLHIAGDYIFSCVGCRTL
QRSFLSGLSVCTGIIDSLAPISLTIPIIGETSRKELDQFLRNSKVNNFDPNAEAQRHLSY
QARYRLKKQERLDEHKEEQEQLVTELLGYLPEPPSKPNANPFLLYQKMQWHVCRALADED
KRRLTGDSTAKATINETRAKLGKTWRQLDDLGKKPWIDEIAAQREAYAGKILRYQRLTKE
YEMRAEQIRNDYAAKCQDEPIPDDEARLFMQAQREEEQRKQTQDDNISKSREASDEEYHD
DGSSDSGYNGTRY
Download sequence
Identical sequences Q10135
SPAC23E2.02 NP_592937.1.19918 4896.SPAC23E2.02-1 SPAC23E2_02.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]