SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPAC2C4_15c.1 from Schizosaccharomyces pombe 972h-

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPAC2C4_15c.1
Domain Number 1 Region: 137-271
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.48e-36
Family UAS domain 0.00015
Further Details:      
 
Domain Number 2 Region: 343-424
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.75e-17
Family UBX domain 0.012
Further Details:      
 
Domain Number 3 Region: 1-46
Classification Level Classification E-value
Superfamily UBA-like 0.000000469
Family TAP-C domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPAC2C4_15c.1
Sequence length 427
Comment | SPAC2C4_15c | Schizosaccharomyces pombe 972h- UBX domain protein Ubx2 (428 aa)
Sequence
MDGDEASLVANFCAITNSTPEKAQEYLSVADGDLSTAITLFFESGGVTDVQSSYIEAPSQ
TEPVEEIRAPIAPTREVLVDPLADMSAGTSIMGNNFGFGGFPRMNRRQRRRMGIFDQSPS
QIPFPSSNTEDSSEESDSSSRASRLAKLFRPPYDIISNLSLDEARIEASSQKRWILVNLQ
TSTSFECQVLNRDLWKDESVKEVIRAHFLFLQLLDDEEPGMEFKRFYPVRSTPHIAILDP
RTGERVKEWSKSFTPADFVIALNDFLEGCTLDETSGRKNPLGAKSQKPVEAMSEDEQMHK
AIAASLGNGNSTTESQGESSSQQAESHGVADDTVHKIDSAECDAEEPSPGPNVTRIQIRM
PNGARFIRRFSLTDPVSKVYAYVKGVAEGADKQPFSLTFQRKSLWTSLDSTIKEAGIQNT
ALQFEFQ
Download sequence
Identical sequences O14048
SPAC2C4_15c.1 NP_594518.1.19918 4896.SPAC2C4.15c-1 SPAC2C4.15c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]