SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPAC2F3_12c.1 from Schizosaccharomyces pombe 972h-

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPAC2F3_12c.1
Domain Number 1 Region: 74-249
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.01e-34
Family Thioltransferase 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPAC2F3_12c.1
Sequence length 279
Comment | SPAC2F3_12c | Schizosaccharomyces pombe 972h- conserved eukaryotic protein (280 aa)
Sequence
MTSFPASHGFGPRKRGYQMDLTNVQPVENKPAWISMKSPLEKEIANEYEALKVTERKEDT
QDYNEPELHNSNDPTVDLYADTYATQAATESDSELEDALFSQLDEFDDTAYREQRLEMLK
KEFARVEAAKEKGHMQFLTVENEREVMDFTLSSKKVVIHFYHPDFIRCKIIDSHLEKIAK
VHWETKFIRIEAANAPFLVVKLGLKVLPAVLCYVNSQLVDKIIGFADLGNKDDFETSLLE
FRLLKSSAIDRLKEESSSNKSIYHDELQNNQSDDSDFFE
Download sequence
Identical sequences O14095
SPAC2F3_12c.1 SPAC2F3.12c NP_001018268.1.19918 4896.SPAC2F3.12c-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]