SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPAC32A11_03c.1 from Schizosaccharomyces pombe 972h-

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPAC32A11_03c.1
Domain Number 1 Region: 155-223
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000513
Family Homeodomain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPAC32A11_03c.1
Sequence length 942
Comment | SPAC32A11_03c | Schizosaccharomyces pombe 972h- homeobox transcription factor Phx1 (943 aa)
Sequence
MRSYSNPENGGQINDNINYSEKRPTMLPENLSLSNYDMDSFLGQFPSDNNMQLPHSTYEQ
HLQGEQQNPTNPNYFPPEFDENKVDWKQEKPKPDAPSFADNNSFDNVNSSKLTNPSPVQP
NIVKSESEPANSKQNEVVEATSVEKAKENVAHESGTPESGGSTSAPKSKKQRLTADQLAY
LLREFSKDTNPPPAIREKIGRELNIPERSVTIWFQNRRAKSKLISRRQEEERQRILREQR
ELDSLNQKVSQAFAHEVLSTSPTSPYVGGIAANRQYANTLLPKPTRKTGNFYMKSGPMQS
SMEPCIAESDIPIRQSLSSTYYNSLSPNAVPVSSQRKYSASSYSAIPNAMSVSNQAFDVE
SPPSSYATPLTGIRMPQPESDLYSYPREVSPSSGGYRMFGHSKPSSYKASGPVRPPNMAT
GHMRTSSEPTSYDSEFYYFSCTLLVIGLWKRLRASPQDLMCFYSPPKKLFAYLIQFQGIQ
YRIEYSFFVIESIHVFRVEEPLLNELSATASSRDKPAPNEYWLQMDIQLSVPPVFHMITS
EGQGNCTDFTEGNQASEVLLHSLMGRATSMFQMLDRVRRASPELGSVIRLQKGLNPHQFL
DPQWANQLPRQPDSSVFDHQGRNPPIQGLSHDTSSEYGNKSQFKRLRSTSTPARQDLAQH
LLPPKTNTEGLMHAQSVSPITQAMKSANVLEGSSTRLNSYEPSVSSAYPHHNLALNLDNT
QFGELGTSNISYPLSAPSDVGSLPRASNSPSRPVMHPNTQGINTEIKDMAAQFPNSQTGG
LTPNSWSMNTNVSVPFTTQNREFGGIGSSSISTTMNAPSQQLSQVPFGDVSLATENSVPS
YGFEVPSEESVYAQARTNSSVSAGVAPRLFIQTPSIPLASSAGQDSNLIEKSSSGGVYAS
QPGASGYLSHDQSGSPFEDVYSPSAGIDFQKLRGQQFSPDMQ
Download sequence
Identical sequences Q10328
SPAC32A11.03c NP_593776.1.19918 4896.SPAC32A11.03c-1 SPAC32A11_03c.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]