SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPAPB17E12_11.1 from Schizosaccharomyces pombe 972h-

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPAPB17E12_11.1
Domain Number 1 Region: 30-151
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.46e-16
Family Thioltransferase 0.043
Further Details:      
 
Weak hits

Sequence:  SPAPB17E12_11.1
Domain Number - Region: 141-221
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 0.0785
Family Diacylglycerol kinase-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPAPB17E12_11.1
Sequence length 309
Comment | SPAPB17E12_11 | Schizosaccharomyces pombe 972h- N-oligosaccharyltransferase gamma subunit (predicted) (310 aa)
Sequence
MNFFKILSFFSLFVITCFAKLDLNSKTDADGVIQITGRLFHRIVNGKQDFTTVALFSADS
STMNCDVCRLIEPEFKALANSYKLKYGLDSGIRFTYADFGKNKNLFQDFSIESVPNFWIF
KPKSIQAIHVDLSHGVTASHLAAIVEKHTGKIADIVYKQDQAKRVGAFLSYIIVGAALFF
TRKIIVKIFTSRKVWAALTIITVITLSSGYMFTRIRFSPYSQRGEHGENLWLAGSQQFQF
GAEVQVVSLLYTALTMSSIFLAIVAPKVEGAKRQTLFVIIWLAFLWIGYSFLVDIFKRKV
SMYPFKLLI
Download sequence
Identical sequences Q8TFH3
NP_001018226.1.19918 4896.SPAPB17E12.11-1 SPAPB17E12_11.1 SPAPB17E12.11

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]